powered by:
Protein Alignment CG15719 and Vha14-2
DIOPT Version :9
Sequence 1: | NP_001259499.1 |
Gene: | CG15719 / 32249 |
FlyBaseID: | FBgn0030440 |
Length: | 160 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649614.1 |
Gene: | Vha14-2 / 40748 |
FlyBaseID: | FBgn0037402 |
Length: | 129 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 35/70 - (50%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 ETPQEDVEQFFLTVYRRSNIGIVIIDYDTVKRLRTMMQRCSQLLPVLVTVPNK-----SSLITYL 145
:|..:.:|:.|....||.:|.|::|:......:|..:...:..:|.::.:|:| ||..:.|
Fly 51 DTTPKQIEECFKKFLRRPDIVIILINQVYADMIRPTVDAHNLAVPTVLEIPSKQHPYDSSRDSIL 115
Fly 146 DKKER 150
.:.:|
Fly 116 KRAQR 120
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1436 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR13861 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.