DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15719 and Vha14-2

DIOPT Version :9

Sequence 1:NP_001259499.1 Gene:CG15719 / 32249 FlyBaseID:FBgn0030440 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_649614.1 Gene:Vha14-2 / 40748 FlyBaseID:FBgn0037402 Length:129 Species:Drosophila melanogaster


Alignment Length:70 Identity:16/70 - (22%)
Similarity:35/70 - (50%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ETPQEDVEQFFLTVYRRSNIGIVIIDYDTVKRLRTMMQRCSQLLPVLVTVPNK-----SSLITYL 145
            :|..:.:|:.|....||.:|.|::|:......:|..:...:..:|.::.:|:|     ||..:.|
  Fly    51 DTTPKQIEECFKKFLRRPDIVIILINQVYADMIRPTVDAHNLAVPTVLEIPSKQHPYDSSRDSIL 115

  Fly   146 DKKER 150
            .:.:|
  Fly   116 KRAQR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15719NP_001259499.1 ATP-synt_F 53..139 CDD:280214 12/57 (21%)
Vha14-2NP_649614.1 ATP-synt_F <51..124 CDD:294422 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1436
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13861
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.