DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15719 and Vha14-1

DIOPT Version :9

Sequence 1:NP_001259499.1 Gene:CG15719 / 32249 FlyBaseID:FBgn0030440 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_476969.1 Gene:Vha14-1 / 36731 FlyBaseID:FBgn0262512 Length:124 Species:Drosophila melanogaster


Alignment Length:87 Identity:24/87 - (27%)
Similarity:51/87 - (58%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VAIIACPEVTLGFLLCGVG-YQKDRFRNYMMVESETPQEDVEQFFLTVYRRSNIGIVIIDYDTVK 116
            :::|...:..:||||.||| ..|:|..|:|:|:..|...::|..|....:|.:|.|::|:.:..:
  Fly    12 ISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFLKRDDIDIILINQNCAE 76

  Fly   117 RLRTMMQRCSQLLPVLVTVPNK 138
            .:|.::...:..:|.::.:|:|
  Fly    77 LIRHVIDAHTSPVPAVLEIPSK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15719NP_001259499.1 ATP-synt_F 53..139 CDD:280214 24/87 (28%)
Vha14-1NP_476969.1 V_ATP_synt_F 5..119 CDD:130171 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1436
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - P PTHR13861
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.