DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15719 and vma7

DIOPT Version :9

Sequence 1:NP_001259499.1 Gene:CG15719 / 32249 FlyBaseID:FBgn0030440 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_596676.1 Gene:vma7 / 2540982 PomBaseID:SPBC3B9.18c Length:120 Species:Schizosaccharomyces pombe


Alignment Length:107 Identity:28/107 - (26%)
Similarity:55/107 - (51%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VAIIACPEVTLGFLLCGVG-YQKDRFRNYMMVESETPQEDV-EQFFLTVYRRSNIGIVIIDYDTV 115
            |::|...:...|.||.|.| ..::..:|:.::..:|..|.: |.|.....:|.:|.||:|:....
pombe    12 VSVIGDDDTVTGMLLAGTGQVNENGDKNFFIITQKTTDEQIAEAFDDYTTKRKDIAIVLINQFAA 76

  Fly   116 KRLRTMMQRCSQLLPVLVTVPNKSSLITYLDKKER-NRRLRQ 156
            :|:|..::...|..|.::.:|:|..  .|..:|:. .||:|:
pombe    77 ERIRDRIENHVQAFPAVLEIPSKDD--PYDPEKDSILRRVRK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15719NP_001259499.1 ATP-synt_F 53..139 CDD:280214 22/87 (25%)
vma7NP_596676.1 ATP-synt_F 8..120 CDD:294422 28/107 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - O PTHR13861
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.