DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15719 and Atp6v1f

DIOPT Version :9

Sequence 1:NP_001259499.1 Gene:CG15719 / 32249 FlyBaseID:FBgn0030440 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_446336.1 Gene:Atp6v1f / 116664 RGDID:621552 Length:119 Species:Rattus norvegicus


Alignment Length:87 Identity:25/87 - (28%)
Similarity:49/87 - (56%) Gaps:1/87 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VAIIACPEVTLGFLLCGVG-YQKDRFRNYMMVESETPQEDVEQFFLTVYRRSNIGIVIIDYDTVK 116
            :|:|...:...||||.|:| ..|:|..|:::||.:|...::|..|.....|.:|||::|:....:
  Rat     8 IAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAE 72

  Fly   117 RLRTMMQRCSQLLPVLVTVPNK 138
            .:|..:....:.:|.::.:|:|
  Rat    73 MVRHALDAHQRSIPAVLEIPSK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15719NP_001259499.1 ATP-synt_F 53..139 CDD:280214 25/87 (29%)
Atp6v1fNP_446336.1 V_ATP_synt_F 1..115 CDD:130171 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102324
Panther 1 1.100 - - O PTHR13861
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.