DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and Spink12

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_084337.2 Gene:Spink12 / 78242 MGIID:1925492 Length:87 Species:Mus musculus


Alignment Length:61 Identity:17/61 - (27%)
Similarity:25/61 - (40%) Gaps:15/61 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GPMQIQYVDYQPNCQPGG-------VPVCATNGTDSFYFENHC-----RLEAANMKMLFQH 125
            |..|....:|:....|.|       .|||   |||...::|.|     .:|.:..|:.|:|
Mouse    26 GGFQAFCSNYEKTLAPDGKSCPKTHKPVC---GTDGKTYQNRCAFCQTAMERSLGKLGFKH 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052
Spink12NP_084337.2 KAZAL_PSTI 42..87 CDD:238648 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.