powered by:
Protein Alignment CG12716 and Spink12
DIOPT Version :9
Sequence 1: | NP_572845.1 |
Gene: | CG12716 / 32248 |
FlyBaseID: | FBgn0030439 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_084337.2 |
Gene: | Spink12 / 78242 |
MGIID: | 1925492 |
Length: | 87 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 17/61 - (27%) |
Similarity: | 25/61 - (40%) |
Gaps: | 15/61 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 GPMQIQYVDYQPNCQPGG-------VPVCATNGTDSFYFENHC-----RLEAANMKMLFQH 125
|..|....:|:....|.| .||| |||...::|.| .:|.:..|:.|:|
Mouse 26 GGFQAFCSNYEKTLAPDGKSCPKTHKPVC---GTDGKTYQNRCAFCQTAMERSLGKLGFKH 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12716 | NP_572845.1 |
KAZAL_FS |
146..192 |
CDD:238052 |
|
Spink12 | NP_084337.2 |
KAZAL_PSTI |
42..87 |
CDD:238648 |
13/45 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.