Sequence 1: | NP_572845.1 | Gene: | CG12716 / 32248 | FlyBaseID: | FBgn0030439 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_698980.5 | Gene: | tmeff1a / 570409 | ZFINID: | ZDB-GENE-070912-294 | Length: | 336 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 48/232 - (20%) |
---|---|---|---|
Similarity: | 79/232 - (34%) | Gaps: | 93/232 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 ILILLQVLGILGRGVLAQKSSPIANWHMADPHYTSDQYAKILGEAGLGQDADDKEHKGLGPMQIQ 82
Fly 83 YVDYQPNCQPGGV---------------------PVCATNGTDSFYFENHCRLEAANMKMLFQHG 126
Fly 127 TE-------------------LEPTEMERCLPNCQ-TMKCTQVE----------------RPVCA 155
Fly 156 LAEIGGAIPQTFANECEMRKHECHTKQVLRILHTGPC 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12716 | NP_572845.1 | KAZAL_FS | 146..192 | CDD:238052 | 12/61 (20%) |
tmeff1a | XP_698980.5 | KAZAL | 81..125 | CDD:197624 | 10/44 (23%) |
KAZAL | 169..215 | CDD:197624 | 11/51 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |