DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and tmeff1a

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_698980.5 Gene:tmeff1a / 570409 ZFINID:ZDB-GENE-070912-294 Length:336 Species:Danio rerio


Alignment Length:232 Identity:48/232 - (20%)
Similarity:79/232 - (34%) Gaps:93/232 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILILLQVLGILGRGVLAQKSSPIANWHMADPHYTSDQYAKILGEAGLGQDADDKEHKGLGPMQIQ 82
            :|:||:|.|.|                |.|    :|......||.|....:.:|  .||      
Zfish    20 LLLLLRVPGAL----------------MTD----TDTDCSTHGEHGCEGLSGNK--SGL------ 56

  Fly    83 YVDYQPNCQPGGV---------------------PVCATNGTDSFYFENHCRLEAANMKMLFQHG 126
            :|..:.:|..||:                     |||.::| |:::.|...|..|...:......
Zfish    57 HVCNESSCVFGGICRDNGSHLECLCQFQCPRMFDPVCGSDG-DTYHSECFLRQAACEQQSPITII 120

  Fly   127 TE-------------------LEPTEMERCLPNCQ-TMKCTQVE----------------RPVCA 155
            ||                   |||:...|| .:|: ..:|.:..                .||| 
Zfish   121 TEGHCPDAESASGDTDLESSGLEPSSYSRC-SSCRFGAECDEDSEGIWCVCNIDCGGYNLNPVC- 183

  Fly   156 LAEIGGAIPQTFANECEMRKHECHTKQVLRILHTGPC 192
                 |:..|:::|.|::|:..|..:..:.:.|.|.|
Zfish   184 -----GSDGQSYSNPCQVREASCLKQAQINVRHLGQC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 12/61 (20%)
tmeff1aXP_698980.5 KAZAL 81..125 CDD:197624 10/44 (23%)
KAZAL 169..215 CDD:197624 11/51 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.