DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and tmeff1b

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001020472.1 Gene:tmeff1b / 553511 ZFINID:ZDB-GENE-050706-143 Length:364 Species:Danio rerio


Alignment Length:157 Identity:37/157 - (23%)
Similarity:58/157 - (36%) Gaps:53/157 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 QPNCQPGGVPVCATNGTDSFYFENHCRLE--AANMK---MLFQHGT------------ELEPTEM 134
            |..|....:|||.|||..   ::|.|.|:  |.|.:   :|...|.            |.:.:.:
Zfish    91 QFQCSKNYIPVCGTNGDT---YQNECYLKQAACNQQKSIVLANEGPCDPDSSSGSGNGEFDGSGL 152

  Fly   135 E------RCLPNCQ-----------------TMKCT-QVERPVCALAEIGGAIPQTFANECEMRK 175
            |      :| .||:                 .:.|: ..|.|||      |....::.|.|.:|:
Zfish   153 ESGKKVTKC-SNCKYGAECDEDAEDEDSCSCKIDCSGHNENPVC------GTDGNSYHNPCLVRE 210

  Fly   176 HECHTKQVLRILHTGPCQTPTKSGRKK 202
            ..|..::.:.:.|.|.|  |.|...||
Zfish   211 ASCMKQEQIDVKHLGRC--PDKDKSKK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 12/46 (26%)
tmeff1bNP_001020472.1 KAZAL 89..134 CDD:197624 15/45 (33%)
KAZAL 182..227 CDD:197624 12/50 (24%)
PHA02887 <263..300 CDD:165214
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12169
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.