DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and CG32354

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_729380.1 Gene:CG32354 / 50302 FlyBaseID:FBgn0052354 Length:662 Species:Drosophila melanogaster


Alignment Length:117 Identity:32/117 - (27%)
Similarity:44/117 - (37%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NCQP----GGVPVCATNGTDSFYFENHCRLEAANMKMLFQHGTEL--------EPTEMERCLPNC 141
            :|.|    |..|||   |:|...:.|.|.|   ..|...:.|..|        |.::...|...|
  Fly   167 SCPPSITVGAEPVC---GSDGLIYANICEL---RKKTCSRSGVSLIKDVRDGCERSKGSDCKHRC 225

  Fly   142 QTMKCTQVERPVCALAEIGGAIPQTFANECEMRKHECHT-KQVLRILHTGPC 192
            .|.|     .|||      |...:|:.|.|.:|...|.. ...:::.|.|||
  Fly   226 STEK-----DPVC------GTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 11/46 (24%)
CG32354NP_729380.1 KAZAL_FS 163..>200 CDD:294071 12/38 (32%)
KAZAL 220..266 CDD:197624 15/56 (27%)
KAZAL_FS 326..>359 CDD:294071
KAZAL 380..430 CDD:197624
KAZAL 452..493 CDD:197624
KAZAL 502..>536 CDD:197624
KAZAL_FS 553..597 CDD:294071
KAZAL 606..650 CDD:197624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10913
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.