DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and Spink14

DIOPT Version :10

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001034307.2 Gene:Spink14 / 433178 MGIID:3646952 Length:96 Species:Mus musculus


Alignment Length:47 Identity:10/47 - (21%)
Similarity:19/47 - (40%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 CTQVERPVCALAEIGGAIPQTFANECEMRKHECHTKQVLRILHTGPC 192
            |..:::|:|      |....|:.|.|.:......:...:|..:.|.|
Mouse    56 CPDLKQPIC------GTNFVTYDNPCILCVESLKSGGRIRYYYNGRC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 9/45 (20%)
Spink14NP_001034307.2 KAZAL_FS 55..96 CDD:412159 9/45 (20%)

Return to query results.
Submit another query.