DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and CG1077

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_649617.1 Gene:CG1077 / 40751 FlyBaseID:FBgn0037405 Length:730 Species:Drosophila melanogaster


Alignment Length:443 Identity:103/443 - (23%)
Similarity:151/443 - (34%) Gaps:154/443 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PMQIQYVDYQP---------NCQPGGVPVCATNGTDSFYFENHCRL-----EAANMKMLFQHGTE 128
            |.:..||...|         :|..|..|||......|..|.|.|.|     :..|...:..:|. 
  Fly   268 PARKPYVVVPPKSKRRIPTKSCVFGNEPVCGNLRGQSRTFSNVCELMEFSQKVGNAWTIAHNGA- 331

  Fly   129 LEPTEMERCLPNCQTMKCTQVERPVCALAEIGGAIPQTFANECEMRKHEC-HTKQVLRILHTGPC 192
                 ..||...|.|     |.:|:||..   ..|..|..|||.:.:..| ..|.:.::.|.|.|
  Fly   332 -----CRRCDKTCPT-----VYQPICATR---NGINHTIVNECYLERVRCKDPKSIWKLSHKGEC 383

  Fly   193 QTPTKSGRKKKLRRNKKKRPTLNASISKFATIPKKVYIMLATPAPRSSSTTPRPFFSTTTTRITT 257
            .....:.|  .:....|.|||        :.:|..:|        ..|:||||..|.....|.||
  Fly   384 AKSVSNPR--HIYSTGKSRPT--------SLVPSVLY--------GKSTTTPRSRFRKPVRRFTT 430

  Fly   258 TARMRPTKP-----------TSTSPS------PMRFQQL-------MNVANPMVSVSQAIDAY-- 296
            |  ..||.|           ::||||      .:|..:|       :..::....:|...||:  
  Fly   431 T--RTPTTPYKPRQLAMTNFSATSPSLETNNRKIRKIELAAAGFSGLGASSGSNFLSSEEDAFWS 493

  Fly   297 ------------NVYNI-----PDVGHDYGEITDSSLSMFLPEVGRVTEPYSVPPRTTTKTTSTT 344
                        ||..:     ..:..::||  ...||.::           ||||.|:..::||
  Fly   494 SDDSWLVQKTLDNVKGLLGNKPTSLKKEHGE--KYPLSYWI-----------VPPRQTSTISTTT 545

  Fly   345 RA---------------------------------------TT---TSTTTPKPVLATSRIITPL 367
            .|                                       ||   |::|||.|...|...||..
  Fly   546 AAPPAKLPAILSMASTELLNLDFGNPSSAYEEADHEAMLMLTTKEGTTSTTPVPSTTTPPNITEP 610

  Fly   368 STSTMQSFLSVRMPSTTEMVEESTT---ENPEASTQAFSTT----QKSTATAQ 413
            ||:.:.:.:.|...|...:.|:|||   |..:.:|...|:|    |.||..|:
  Fly   611 STTELPTSVDVASDSAETVSEDSTTDFGETTDPTTSNDSSTSDAPQSSTTEAE 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 13/46 (28%)
CG1077NP_649617.1 KAZAL_FS 86..131 CDD:238052
KAZAL_FS 149..193 CDD:294071
KAZAL 335..383 CDD:197624 16/55 (29%)
Podoplanin <612..688 CDD:283467 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10913
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.