DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and Reck

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster


Alignment Length:276 Identity:55/276 - (19%)
Similarity:85/276 - (30%) Gaps:108/276 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YAKILGEAGLGQDA-------------DDKEHKGLGPMQIQYVDY----------QPNCQPGGVP 96
            |:.|.| ..||||:             ....||.|...|....::          ...|||  :|
  Fly   609 YSCIPG-CNLGQDSKLFVPFGSYVRLGKSNLHKKLEVGQFPLAEHIVCSCGLQGRLEQCQP--LP 670

  Fly    97 VCATNGTDSFYFENHCRLEAANMKMLFQHGT--------------ELEPTEMERCLPN------- 140
                     .|...||.|..|..   ::||:              |:..|:.:..||.       
  Fly   671 ---------SYMHAHCTLPGARS---YRHGSSFYLECNLCSCFAGEITCTKQQCRLPGFVDSGYT 723

  Fly   141 ---CQTMKCTQVERPVCALAEIGGAIPQTFANECEMRKH---------ECHTKQVLRILHTGPCQ 193
               |   .|.....|||      |:...|:.:.|..:.|         .|:.:...:......|.
  Fly   724 SLPC---NCPAHYVPVC------GSNGNTYPSACVAKCHLPEGDYVYGACNARNACQAAPPNSCP 779

  Fly   194 TPTKSGRKKKLRRNKKKRPTL-----NASISKFATI-------------PKKVYIMLATP----- 235
            :.|:....:|:.....:||.|     ||:.|..:|.             |....::.|.|     
  Fly   780 SGTQCLDSRKVCLASMQRPCLQYVCVNATASNCSTFHQGEVCDSQGRTYPNACALLKANPQGQVA 844

  Fly   236 ---APRSS--STTPRP 246
               |.:||  :|:|.|
  Fly   845 YWSACQSSRFNTSPSP 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 9/54 (17%)
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.