| Sequence 1: | NP_572845.1 | Gene: | CG12716 / 32248 | FlyBaseID: | FBgn0030439 | Length: | 418 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001164077.1 | Gene: | Spink5 / 361319 | RGDID: | 1306540 | Length: | 1019 | Species: | Rattus norvegicus |
| Alignment Length: | 229 | Identity: | 42/229 - (18%) |
|---|---|---|---|
| Similarity: | 75/229 - (32%) | Gaps: | 74/229 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 GRGVLAQKSSPI------------ANWHMADPHYTSDQYAKILGEAGLGQDADDKEHKGLGPMQI 81
Fly 82 QYVDYQP----------------------NCQPGGVPVC-----ATNGTDSFYFENHCRL----- 114
Fly 115 ------------EAANMKMLFQHGTELEPTEME-------RCLPNCQTMKCTQVERPVCALAEIG 160
Fly 161 GAIPQTFANECEMRKHECHTKQVLRILH-TGPCQ 193 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12716 | NP_572845.1 | KAZAL_FS | 146..192 | CDD:238052 | 16/46 (35%) |
| Spink5 | NP_001164077.1 | KAZAL_PSTI | 109..153 | CDD:238648 | |
| Kazal_2 | 177..>209 | CDD:284958 | |||
| KAZAL | 241..278 | CDD:197624 | |||
| Kazal_2 | 314..348 | CDD:284958 | |||
| Kazal_2 | 383..418 | CDD:284958 | |||
| Kazal_2 | 442..476 | CDD:284958 | |||
| KAZAL | 576..616 | CDD:197624 | |||
| KAZAL_FS | 651..>675 | CDD:294071 | |||
| KAZAL | 716..>741 | CDD:197624 | |||
| KAZAL | 784..821 | CDD:197624 | 7/38 (18%) | ||
| KAZAL_PSTI | 954..998 | CDD:238648 | 16/51 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3649 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||