DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and agr-1

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001022152.3 Gene:agr-1 / 3565243 WormBaseID:WBGene00018304 Length:1473 Species:Caenorhabditis elegans


Alignment Length:225 Identity:60/225 - (26%)
Similarity:86/225 - (38%) Gaps:69/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILLQVLGILGRGVLAQ--------------KSSPIANWHMAD-------PHYTSDQYAKILGEAG 63
            ::.|:.|||    ||:              :|||:.:.|..|       .|:..:....|..:. 
 Worm   238 VVNQINGIL----LAKCVCPTQCPNYGDSVESSPVCSSHGVDYQSSCHLRHHACESKTNITVKF- 297

  Fly    64 LGQDADDKEHKGLGPMQIQY-VDYQPNCQPGGVPVCATN-----GTDSFYFENHCRLEAANMK-- 120
            .|:......||.......|. ||.:|.|:..  ..|..|     |||...:.|.|.|:.|..|  
 Worm   298 FGRCDPCHGHKCPNGQTCQLGVDRRPECKCS--EQCTMNSAHVCGTDGKTYLNECFLKLAACKEQ 360

  Fly   121 ---MLFQHGTELE---PTEMERC-----------------LPNCQTMKCTQVERPVCALAEIGGA 162
               ::::.|...|   |.|...|                 .||    :|..|.|||||   ..| 
 Worm   361 KDILVWKRGNCDEAGSPCEKMECGFWGSCVVKPDRTAECECPN----RCEDVMRPVCA---TNG- 417

  Fly   163 IPQTFANECEMRKHECHTKQVLRILHTGPC 192
              :||.|||||:|..|.||.::::.|.|.|
 Worm   418 --ETFDNECEMKKKSCETKSMIKVKHQGTC 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 21/45 (47%)
agr-1NP_001022152.3 KAZAL 172..220 CDD:197624
KAZAL 251..301 CDD:197624 8/50 (16%)
KAZAL 327..371 CDD:197624 11/45 (24%)
KAZAL 400..445 CDD:197624 23/54 (43%)
KAZAL 472..516 CDD:197624
KAZAL 547..592 CDD:197624
KAZAL 612..660 CDD:197624
EGF_Lam 670..716 CDD:238012
EGF_Lam 722..>759 CDD:238012
KAZAL <819..852 CDD:197624
LamG 1081..1236 CDD:238058
LamG 1289..1450 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I8072
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.