| Sequence 1: | NP_572845.1 | Gene: | CG12716 / 32248 | FlyBaseID: | FBgn0030439 | Length: | 418 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036693.1 | Gene: | Fst / 24373 | RGDID: | 2633 | Length: | 344 | Species: | Rattus norvegicus |
| Alignment Length: | 172 | Identity: | 30/172 - (17%) |
|---|---|---|---|
| Similarity: | 57/172 - (33%) | Gaps: | 72/172 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 VDYQPNCQ--------PGGVPVCATNGTDSFY-------------------------FENHCRLE 115
Fly 116 AANMKMLFQHGTELEPTEMERCL--PNCQTMKC--------------------------TQVERP 152
Fly 153 VCALAEIGGAIPQTFANECEMRKHECHTKQVLRILHTGPCQT 194 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12716 | NP_572845.1 | KAZAL_FS | 146..192 | CDD:238052 | 14/71 (20%) |
| Fst | NP_036693.1 | FOLN | 94..117 | CDD:128570 | |
| KAZAL | 117..164 | CDD:197624 | 3/5 (60%) | ||
| FOLN | 167..190 | CDD:128570 | 5/23 (22%) | ||
| KAZAL | 192..239 | CDD:197624 | 4/50 (8%) | ||
| KAZAL | 270..316 | CDD:197624 | 13/51 (25%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 315..344 | 1/4 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||