DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and Spink4

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_035593.2 Gene:Spink4 / 20731 MGIID:1341848 Length:86 Species:Mus musculus


Alignment Length:62 Identity:17/62 - (27%)
Similarity:21/62 - (33%) Gaps:25/62 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PNCQPGGVPVCATNGTDSFYFENHCRLEAANMKMLFQHGTELEPTEMERCLPNCQTMKCTQV 149
            |||......:|   |||...:||.|.|                      ||...:|||..|:
Mouse    44 PNCPQTPNLIC---GTDGLTYENECHL----------------------CLTRMKTMKDIQI 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 1/4 (25%)
Spink4NP_035593.2 KAZAL_FS 42..86 CDD:294071 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.