powered by:
Protein Alignment CG12716 and Spink4
DIOPT Version :9
Sequence 1: | NP_572845.1 |
Gene: | CG12716 / 32248 |
FlyBaseID: | FBgn0030439 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_035593.2 |
Gene: | Spink4 / 20731 |
MGIID: | 1341848 |
Length: | 86 |
Species: | Mus musculus |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 21/62 - (33%) |
Gaps: | 25/62 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 PNCQPGGVPVCATNGTDSFYFENHCRLEAANMKMLFQHGTELEPTEMERCLPNCQTMKCTQV 149
|||......:| |||...:||.|.| ||...:|||..|:
Mouse 44 PNCPQTPNLIC---GTDGLTYENECHL----------------------CLTRMKTMKDIQI 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.