DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12716 and tmeff2a

DIOPT Version :9

Sequence 1:NP_572845.1 Gene:CG12716 / 32248 FlyBaseID:FBgn0030439 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001121837.1 Gene:tmeff2a / 100004613 ZFINID:ZDB-GENE-070912-622 Length:379 Species:Danio rerio


Alignment Length:207 Identity:43/207 - (20%)
Similarity:74/207 - (35%) Gaps:72/207 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 CQPGGVPVCATNGTDSFYFENHCRL-----------------------------EAANMKM---- 121
            |....||||.:|..:   :||.|.|                             ||.|...    
Zfish    99 CNNDYVPVCGSNNEN---YENECFLRRDACKQQTEILVVSEGSCPADAGSGSGDEAGNEGSAENG 160

  Fly   122 --------LFQHGTELE-PTEMERCLPNCQTMKCTQVE-RPVCALAEIGGAIPQTFANECEMRKH 176
                    :.|.|.|.: ..|...|:.|   :.|:.:. .||||      :..:::.|.|::::.
Zfish   161 QKETSTCDICQFGAECDVDAEDVWCVCN---IDCSHISFNPVCA------SDGRSYDNPCQVKEA 216

  Fly   177 ECHTKQVLRILHTGPCQ----TPTKSGRKKKLRRNKKKRPTLNASISKFATIP----KKVYI--- 230
            .|..::.:.:...|.||    |.||:|..:..|.:..:.....:.:::...||    .|.|.   
Zfish   217 SCQRQERIEVKFLGHCQGDMITGTKAGDGQYARTDYTEEKPEVSEVARGLYIPCPEHYKNYCVHG 281

  Fly   231 ------MLATPA 236
                  ||:||:
Zfish   282 DCEYPNMLSTPS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12716NP_572845.1 KAZAL_FS 146..192 CDD:238052 9/46 (20%)
tmeff2aNP_001121837.1 KAZAL_FS 99..139 CDD:238052 10/42 (24%)
KAZAL 186..232 CDD:197624 10/54 (19%)
PHA02887 <266..306 CDD:165214 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.