DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and GLP2R

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_011522379.1 Gene:GLP2R / 9340 HGNCID:4325 Length:578 Species:Homo sapiens


Alignment Length:391 Identity:100/391 - (25%)
Similarity:184/391 - (47%) Gaps:67/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LFCPLNFDGYLCWPRTPAGTVLSQYCPDF----------VEG----FNRKFLAHKTCLE---NGS 165
            :||...||.|:|||.:..|.| |..||.:          ::|    |:.|...:|...:   :|.
Human    94 IFCNGTFDQYVCWPHSSPGNV-SVPCPSYLPWWSEDHQQIQGQLKLFSGKISGYKLQAKQESSGR 157

  Fly   166 WYRHPVSNQTWSNYTNCVDY--------EDLEFRQFINE---------LYVKGYALSLLALLISI 213
            .|||.::..||....|..|.        |:..|:|.::.         :|..||:.||::|.:::
Human   158 AYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQLMYTVGYSFSLISLFLAL 222

  Fly   214 IIFLGFKSLRCTRIRIHVHLFASLACTCVAW----ILWYRLVVERSET-------IAENPLWCIG 267
            .:.|..:.|.|||..||::||||.....:|.    :::|....:|.:.       ::|....|..
Human   223 TLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYSKRPDNENGWMSYLSEMSTSCRS 287

  Fly   268 LHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLAR-HFSS 331
            :.:::|||:..||.|:..|||:||.:|....:.:..:...::::.|..|:...:.:|.|| |.  
Human   288 VQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLWPRYLLLGWAFPVLFVVPWGFARAHL-- 350

  Fly   332 PDNKHCWIT--DSLYLWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPAPLAIR----KAV 390
             :|..||.|  :....||...|:.|.:..:|...:.:|::::.||....     :..|    :..
Human   351 -ENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLKILKLLISKLKAHQ-----MCFRDYKYRLA 409

  Fly   391 RATIILVPLFGLQHFLLPYRPDAGTQLDHFYQM----LSVVLVSLQGFVVSFLFCFANHDVTFAI 451
            ::|::|:||.|:...|..:..|  .|::.|.::    :.:.|.|..||:|:..:.|||.:|...:
Human   410 KSTLVLIPLLGVHEILFSFITD--DQVEGFAKLIRLFIQLTLSSFHGFLVALQYGFANGEVKAEL 472

  Fly   452 R 452
            |
Human   473 R 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 24/83 (29%)
7tm_4 216..436 CDD:304433 60/241 (25%)
GLP2RXP_011522379.1 HRM 93..187 CDD:280888 25/93 (27%)
7tm_2 200..457 CDD:278432 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.