DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and Inmt

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001102492.1 Gene:Inmt / 368066 RGDID:1597087 Length:264 Species:Rattus norvegicus


Alignment Length:243 Identity:46/243 - (18%)
Similarity:78/243 - (32%) Gaps:96/243 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATDYDSDLPENFSPVPRYLENAAMNEGVIDMRNVDEELAEKE-----------ELMATV------ 104
            ||||   .|:|...:.::|:.   ..|..|..::.:.:.|.|           :|..||      
  Rat    84 ATDY---TPQNLQELQKWLKK---EPGAYDWSSIVQHVCELEGDRSRWQEKEAKLRRTVTRVLRC 142

  Fly   105 -VSATMATNQKENRLF-CPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLENGSWY 167
             |:.|......:..|. |.|.|....|            .||| |:.:..........|:.|.  
  Rat   143 DVTKTPPLGSAQVPLADCVLTFLAMEC------------ACPD-VDTYRAALRRLAGLLKPGG-- 192

  Fly   168 RHPVSNQTWSNYTNCVDYEDLEFRQFI------NELYVKGYALSLLALLISIIIFLGFKSLRCTR 226
             |.|:..|            |.|:.::      :.:|::...:.      ..|...||:.||   
  Rat   193 -HLVTLVT------------LRFQHYMVGPKKFSGVYLEKETVE------KAIQDAGFQVLR--- 235

  Fly   227 IRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCI--GLHLVV 272
                        |.||              :::.:..:|:  ||:.||
  Rat   236 ------------CNCV--------------SLSYSEAYCVNDGLYFVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 14/67 (21%)
7tm_4 216..436 CDD:304433 12/59 (20%)
InmtNP_001102492.1 NNMT_PNMT_TEMT 1..260 CDD:250464 46/243 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.