DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and Gipr

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_036846.1 Gene:Gipr / 25024 RGDID:2689 Length:455 Species:Rattus norvegicus


Alignment Length:422 Identity:115/422 - (27%)
Similarity:193/422 - (45%) Gaps:62/422 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ELAEKEELMATVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLA- 156
            ||.::.|........|:...:..:.|.|..:||.|.||..|.|.|.....||.::..: |:..| 
  Rat    31 ELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWY-RQVAAG 94

  Fly   157 --HKTCLENGSWYRHPVSNQTWSNYTNCVD------YED----LEFRQFINELYVKGYALSLLAL 209
              .:.|..:|.|       .:|.::|.|.:      ::|    ||..|.:   |..||:|||..|
  Rat    95 FVFRQCGSDGQW-------GSWRDHTQCENPEKNGAFQDQKLILERLQVV---YTVGYSLSLATL 149

  Fly   210 LISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIA--------ENP-LW- 264
            |::::|...|:.|.|||..||::||.|       ::|....::.|.:.:.        :.| || 
  Rat   150 LLALLILSLFRRLHCTRNYIHMNLFTS-------FMLRAGAILTRDQLLPPLGPYTGNQTPTLWN 207

  Fly   265 -----CIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYG 324
                 |....::..|.:..||.|:..||::||.:||||...:....|.::::.|.:|....|.:.
  Rat   208 QALAACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCYLLLGWGAPALFVIPWV 272

  Fly   325 LARHFSSPDNKHCWITDSL--YLWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPAPLAIR 387
            :.|:..  :|..||..:.:  ..||...||.:::|.:|:..|.:|.::|.||..:..:.....:|
  Rat   273 IVRYLY--ENTQCWERNEVKAIWWIIRTPILITILINFLIFIRILGILVSKLRTRQMRCPDYRLR 335

  Fly   388 KAVRATIILVPLFGLQHFLLPYRPDAGTQLD---HFYQM-LSVVLVSLQGFVVSFLFCFANHDVT 448
            .| |:|:.|:||.|:...:  :.|....|.:   .|.:: ..:.|.|.|||:||.|:||.|.:|.
  Rat   336 LA-RSTLTLMPLLGVHEVV--FAPVTEEQAEGSLRFAKLAFEIFLSSFQGFLVSVLYCFINKEVQ 397

  Fly   449 FAIRTLLNKLLPSLVTPPPAGSNTGQMATTTP 480
            ..||.|...|......|     :.||.....|
  Rat   398 SEIRRLRLSLQEQCPRP-----HLGQAPRAVP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 20/75 (27%)
7tm_4 216..436 CDD:304433 63/240 (26%)
GiprNP_036846.1 HRM 55..118 CDD:280888 20/70 (29%)
7tm_2 131..385 CDD:278432 75/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X66
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.