DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and FBXO46

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001073938.1 Gene:FBXO46 / 23403 HGNCID:25069 Length:603 Species:Homo sapiens


Alignment Length:215 Identity:52/215 - (24%)
Similarity:71/215 - (33%) Gaps:66/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DDPSFSLGPATDYDSDLPENFSPVPRYLENAA------MNEGVID---------MRNVDEELAEK 97
            |:.|....||.....|.|....|.|.....|:      :..||:|         .:||.||    
Human   331 DEASEGDSPAPARPEDTPPAPPPPPARDCGASGFHVDVVVTGVVDECIFFGKDGTKNVKEE---- 391

  Fly    98 EELMATVVSATMATNQ--KENRLFCPLNF--DGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHK 158
                  .|..|::..:  ...:||...|.  ||....|  ||.:..:...||..||.....|.. 
Human   392 ------TVCLTVSPEEPPPPGQLFFLQNRGPDGPPEPP--PADSPATAPGPDDAEGTADTSLCR- 447

  Fly   159 TCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYVKGYALSLLA--LLISIIIFLGFKS 221
                   .|||             |.::.||.|..|..|......:.||.  :|:.|..||..::
Human   448 -------LYRH-------------VSHDFLEIRFKIQRLLEPRQYMLLLPEHVLVKIFSFLPTRA 492

  Fly   222 LRCTRIRIHVHLFASLACTC 241
            |            |:|.|||
Human   493 L------------AALKCTC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 17/68 (25%)
7tm_4 216..436 CDD:304433 8/26 (31%)
FBXO46NP_001073938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..163
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..301
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..360 8/28 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..440 12/45 (27%)
F-box-like 473..>507 CDD:289689 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.