DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and Inmt

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_033375.1 Gene:Inmt / 21743 MGIID:102963 Length:264 Species:Mus musculus


Alignment Length:118 Identity:30/118 - (25%)
Similarity:43/118 - (36%) Gaps:42/118 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 VLRVIVRKLHPQSAQPAPLA------------------IRKAVR--ATII-----LVPLFGL--Q 403
            |||..|.|..|..:...|||                  .|.|:|  |.::     ||.|..|  |
Mouse   139 VLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDIDTYRAALRRLAGLLKPGGHLVTLVTLRFQ 203

  Fly   404 HFLLPYRPDAGTQL----------DHFYQMLSVVLVSLQGFVVSFLFCFANHD 446
            |:::..:..:|..|          |...|:|....|||     |:...:.:||
Mouse   204 HYMVGPKKFSGVYLEKEVVEKAIQDAGCQVLKCNCVSL-----SYSEAYCSHD 251

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888
7tm_4 216..436 CDD:304433 27/106 (25%)
InmtNP_033375.1 NNMT_PNMT_TEMT 1..260 CDD:250464 30/118 (25%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 64..65