DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and CRHR2

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001189404.1 Gene:CRHR2 / 1395 HGNCID:2358 Length:438 Species:Homo sapiens


Alignment Length:372 Identity:113/372 - (30%)
Similarity:193/372 - (51%) Gaps:38/372 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EELMATVVSATMATNQKENRLFCPLNFDGY-LCWPRTPAGTVLSQYCPDFVEG--FNRKFLAHKT 159
            |:...|:::   .||......:|....|.. .||||:.||.::.:.||::..|  :|....|::.
Human    48 EQYCHTIMT---LTNLSGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRE 109

  Fly   160 CLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQF---------INELYVKGYALSLLALLISIII 215
            |||||:|       .:..||:.|....|.:.|::         :|.|   |:.:|:.||:.:.::
Human   110 CLENGTW-------ASKINYSQCEPILDDKQRKYDLHYRIALVVNYL---GHCVSVAALVAAFLL 164

  Fly   216 FLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNY 280
            ||..:|:||.|..||.:|..:.   .:..::|:.|.:...|....|.:||..:..:.:||::.|:
Human   165 FLALRSIRCLRNVIHWNLITTF---ILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNF 226

  Fly   281 FWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSSPDNKHCWI---TDS 342
            ||||.||.:||..:|:.:..:.:....|:.|.|..|.||.:.:.:.:.:.  :|:.||.   ...
Human   227 FWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYY--ENEQCWFGKEPGD 289

  Fly   343 LYLWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPAPLAIRKAVRATIILVPLFGLQHFLL 407
            |..:|:..||.|.||.:|:||.|::|:::.||. .|.....:..||||:||::|:||.|:.:.|.
Human   290 LVDYIYQGPIILVLLINFVFLFNIVRILMTKLR-ASTTSETIQYRKAVKATLVLLPLLGITYMLF 353

  Fly   408 PYRP--DAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAIR 452
            ...|  |..:|:...|  .:..|.|.|||.||..:||.|.:|..|:|
Human   354 FVNPGEDDLSQIMFIY--FNSFLQSFQGFFVSVFYCFFNGEVRSAVR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 22/69 (32%)
7tm_4 216..436 CDD:304433 71/224 (32%)
CRHR2NP_001189404.1 HormR 63..134 CDD:214468 23/77 (30%)
7tm_2 140..382 CDD:278432 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.