DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and CRHR1

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001138618.1 Gene:CRHR1 / 1394 HGNCID:2357 Length:444 Species:Homo sapiens


Alignment Length:375 Identity:115/375 - (30%)
Similarity:177/375 - (47%) Gaps:75/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CWPRTPAGTVLSQYCPDFVEG--FNRKFLAHKTCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFR 191
            ||||:|||.::.:.||.|..|  :|.....::.||.||||...       .||:.|.:..:.|.:
Human    54 CWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAAR-------VNYSECQEILNEEKK 111

  Fly   192 Q--------FINELYVKGYALSLLALLISIIIFLGF----------------------------- 219
            .        .||.|   |:.:||:|||::.::||..                             
Human   112 SKVHYHVAVIINYL---GHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVR 173

  Fly   220 KSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERS---ETIAENPLWCIGLHLVVHYFMLVNYF 281
            :|:||.|..||.:|.::.......|     .||:.:   |....|..||..:....:||.:.|:|
Human   174 RSIRCLRNIIHWNLISAFILRNATW-----FVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFF 233

  Fly   282 WMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSSPDNKHCWI------- 339
            |||.||.:||..:|:.:..|.:....||.|.|..|.||.:.:.:.:.:.  ||:.||.       
Human   234 WMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYY--DNEKCWFGKRPGVY 296

  Fly   340 TDSLYLWIFSVPITLSLLASFIFLINVLRVIVRKLHPQSAQPAPLAIRKAVRATIILVPLFGLQH 404
            ||    :|:..|:.|.||.:||||.|::|:::.||. .|.....:..||||:||::|:||.|:.:
Human   297 TD----YIYQGPMILVLLINFIFLFNIVRILMTKLR-ASTTSETIQYRKAVKATLVLLPLLGITY 356

  Fly   405 FLLPYRP--DAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAIR 452
            .|....|  |..:::...|  .:..|.|.|||.||..:||.|.:|..|||
Human   357 MLFFVNPGEDEVSRVVFIY--FNSFLESFQGFFVSVFYCFLNSEVRSAIR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 21/57 (37%)
7tm_4 216..436 CDD:304433 75/260 (29%)
CRHR1NP_001138618.1 HormR 40..111 CDD:214468 22/63 (35%)
Important for peptide agonist binding 99..108 2/8 (25%)
7tm_2 116..388 CDD:278432 84/288 (29%)
Important for antagonist binding 309..319 6/9 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5470
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.