DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hec and Crhr2

DIOPT Version :9

Sequence 1:NP_001285174.1 Gene:hec / 32246 FlyBaseID:FBgn0030437 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001275547.1 Gene:Crhr2 / 12922 MGIID:894312 Length:431 Species:Mus musculus


Alignment Length:352 Identity:112/352 - (31%)
Similarity:186/352 - (52%) Gaps:37/352 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FCPLNFDGY-LCWPRTPAGTVLSQYCPDFVEG--FNRKFLAHKTCLENGSW-----YRH--PVSN 173
            :|....|.. .|||::..|.::.:.||::..|  :|....|::.|||||:|     |.|  |:.:
Mouse    59 YCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILD 123

  Fly   174 QTWSNYTNCVDYEDLEFR--QFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFAS 236
            .....|       ||.:|  ..:|.|   |:.:|::||:.:.::||..:|:||.|..||.:|..:
Mouse   124 DKQR
KY-------DLHYRIALIVNYL---GHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITT 178

  Fly   237 LACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKD 301
            .....:||.|   |.:...|....|.:||..:..:.:||::.|:||||.||.:||..:|:.:..:
Mouse   179 FILRNIAWFL---LQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTE 240

  Fly   302 TIVMRW-FIVISWFSPIPIAIVYGLARHFSSPDNKHCWI---TDSLYLWIFSVPITLSLLASFIF 362
            .: .:| |:.|.|..|.||.|.:.:.:.:.  :|:.||.   ...|..:|:..|:.|.||.:|:|
Mouse   241 HL-RKWLFLFIGWCIPCPIIIAWAVGKLYY--ENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVF 302

  Fly   363 LINVLRVIVRKLHPQSAQPAPLAIRKAVRATIILVPLFGLQHFLLPYRP--DAGTQLDHFYQMLS 425
            |.|::|:::.||. .|.....:..||||:||::|:||.|:.:.|....|  |..:|:...|  .:
Mouse   303 LFNIVRILMTKLR-ASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIY--FN 364

  Fly   426 VVLVSLQGFVVSFLFCFANHDVTFAIR 452
            ..|.|.|||.||..:||.|.:|..|:|
Mouse   365 SFLQSFQGFFVSVFYCFFNGEVRAALR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hecNP_001285174.1 HRM 118..185 CDD:280888 21/75 (28%)
7tm_4 216..436 CDD:304433 74/225 (33%)
Crhr2NP_001275547.1 HormR 56..127 CDD:214468 20/67 (30%)
7tm_2 133..375 CDD:278432 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.