DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and AT2G35410

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:223 Identity:61/223 - (27%)
Similarity:96/223 - (43%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSL 85
            |...:..|.|..||.:|:..::..||...|.:.:.:::|.|                   .|::.
plant    90 NSNLKRKLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQK-------------------DGKNR 135

  Fly    86 GYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYAR----PSSESIKGA----------NLYVSG 136
            |:.||.....|:|:.|::..:..::..::|.||:||    |:.:|....          .||||.
plant   136 GFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFARRFKKPTPKSPNDLPSPAPGDTRHKLYVSN 200

  Fly   137 LPKNLSQPDLEGMF--ASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGY 199
            |........|..:|  |.|.. :::|::..:..|.|.|.||:.|..|.|||.||.:||||...| 
plant   201 LAWKARSTHLRELFTAADFNP-VSARVVFADPEGRSSGYGFVSFATREEAENAITKLNGKEIMG- 263

  Fly   200 AEPITVKF---------------ANNPS 212
             .|||:||               |||.|
plant   264 -RPITLKFSLRSASESEDGDSVEANNAS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 60/221 (27%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 56/203 (28%)
RRM_SF 97..168 CDD:409669 18/89 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.