DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and CG34354

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001097953.2 Gene:CG34354 / 5740528 FlyBaseID:FBgn0085383 Length:550 Species:Drosophila melanogaster


Alignment Length:293 Identity:69/293 - (23%)
Similarity:126/293 - (43%) Gaps:78/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GSNDE-SRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQG 82
            |:|.: .:.::.|..|...:..::::..|:..||:..|::|||        |.:|          
  Fly    88 GNNSKPEQFHIFVGDLSAEIETQQLKDAFTPFGEISDCRVVRD--------PQTL---------- 134

  Fly    83 QSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYAR---PSSESIKGA------NLYVSGLP 138
            :|.|||||::|:..:||.|:..:||..|.::.|:.::|.   |::::...|      .:|....|
  Fly   135 KSKGYGFVSFVKKSEAETAITAMNGQWLGSRSIRTNWATRKPPATKADMNAKPLTFDEVYNQSSP 199

  Fly   139 KN---------------LSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAI 188
            .|               |::..|:..|:.:|.|...|:..|      ||..|:||..:..|..||
  Fly   200 TNCTVYCGGINGALSGFLNEEILQKTFSPYGTIQEIRVFKD------KGYAFVRFSTKEAATHAI 258

  Fly   189 QELNGKTPKGYAEPITV---KFANNPSN------SAKAQIAPPLTAYLTPQAAAATRRLAG---- 240
            ..:|.....  .:|:..   |.:.:|::      .|.||..|..:|.....|||..:::||    
  Fly   259 VAVNNTEIN--QQPVKCAWGKESGDPNHMSAIAGGALAQGFPFGSAAAAAAAAAYGQQVAGYWYP 321

  Fly   241 ---ALPSAGRIRYSPLAGDLLANSILPGNAMTG 270
               ..|:|     :|      |:::.||..:.|
  Fly   322 PAPTYPAA-----AP------ASALQPGQFLQG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 67/289 (23%)
CG34354NP_001097953.2 RRM2_TIA1_like 97..171 CDD:240799 25/91 (27%)
RRM3_TIA1_like 202..278 CDD:240800 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.