DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and elavl1

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001005461.1 Gene:elavl1 / 448062 XenbaseID:XB-GENE-481800 Length:326 Species:Xenopus tropicalis


Alignment Length:350 Identity:197/350 - (56%)
Similarity:246/350 - (70%) Gaps:30/350 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKNGSANGSVDGSNDE-SRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPAS 71
            :.||..:...|...|: .|||||||||||.|||:|:|||||||||:||.||:||||:|:      
 Frog     1 MSNGYGDHMDDVCRDDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGH------ 59

  Fly    72 LTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSG 136
                        |||||||||:.|:|||:|:|||||||||:|.||||.|||||||||.||||:||
 Frog    60 ------------SLGYGFVNYLNAKDAERAINTLNGLRLQSKTIKVSVARPSSESIKDANLYISG 112

  Fly   137 LPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAE 201
            ||:.::|.|:|.||..||:||.||:|.|..:|||:||.|||||:|:|||.||...||..|.|.:|
 Frog   113 LPRTMTQKDVEDMFLPFGRIINSRVLVDQATGLSRGVAFIRFDKRSEAEEAIASFNGHKPPGSSE 177

  Fly   202 PITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGAL-PSAGRIRYSPLAGDLLANSILPG 265
            |||||||.||:.:..       .|.|:....:..||..|.: ..|.|.|:||:..|.: :||...
 Frog   178 PITVKFAANPNQNKN-------MALLSQLCHSPARRFGGPVHHQAQRFRFSPMGVDHM-SSISGV 234

  Fly   266 N--AMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAV 328
            |  :...||||||:|||..:.:|.:|||:|||||||.:||||||..|:|||||||||||||:||.
 Frog   235 NVASSASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAA 299

  Fly   329 VAIQSLNGYTLGNRVLQVSFKTNKT 353
            :||.|||||.||::.|||.|||:|:
 Frog   300 MAIASLNGYRLGDKTLQVFFKTSKS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 193/334 (58%)
elavl1NP_001005461.1 RRM 19..326 CDD:330708 193/331 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5618
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 414 1.000 Inparanoid score I1795
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm9409
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.