DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and mod

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:267 Identity:60/267 - (22%)
Similarity:104/267 - (38%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLG 86
            :.:...::|..:...:|::::::.|..:..:|:.     .:|.|.::|.:               
  Fly   254 ENNERTVVVGLIGPNITKDDLKTFFEKVAPVEAV-----TISSNRLMPRA--------------- 298

  Fly    87 YGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGAN---LYVSGLPK--NLSQPDL 146
              ||.....:|..||:. |:...|.::.|.|  .|.|.|||...:   |.|..:.|  :.|...|
  Fly   299 --FVRLASVDDIPKALK-LHSTELFSRFITV--RRISQESISRTSELTLVVENVGKHESYSSDAL 358

  Fly   147 EGMFASFGKIITSRILCDNISGLSKGV-GFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANN 210
            |.:|..||.:....::|      ||.| .|:.|.|.:.|.:|:.:|:|||...:...:. :|..:
  Fly   359 EKIFKKFGDVEEIDVVC------SKAVLAFVTFKQSDAATKALAQLDGKTVNKFEWKLH-RFERS 416

  Fly   211 PSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAG---------------DLLAN 260
            .|..|      .|...||..|..|.  |......:|.|....:.|               ..|||
  Fly   417 TSGRA------ILVTNLTSDATEAD--LRKVFNDSGEIESIIMLGQKAVVKFKDDEGFCKSFLAN 473

  Fly   261 SILPGNA 267
            ..:..||
  Fly   474 ESIVNNA 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 60/266 (23%)
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668 16/91 (18%)
RRM_SF 342..411 CDD:240668 22/74 (30%)
RRM_SF 422..>465 CDD:302621 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.