DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and CG7903

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster


Alignment Length:143 Identity:31/143 - (21%)
Similarity:47/143 - (32%) Gaps:58/143 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 ANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGK 194
            |.::|..||: ....:|..:|.::|.::.    ||    :.....|:..:..:.||.||..|||.
  Fly     5 AKVFVGSLPR-CKPEELRRLFTNYGSVVE----CD----VMNRCAFVHLENTDMAEAAIAALNGT 60

  Fly   195 TPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLLA 259
            ..||  :||.|:                                      |||.:|.|..|    
  Fly    61 IFKG--QPIVVE--------------------------------------AGRPKYGPGGG---- 81

  Fly   260 NSILPGNAMTGSG 272
                 .....|||
  Fly    82 -----SRGQPGSG 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 31/143 (22%)
CG7903NP_651755.2 RRM <4..168 CDD:223796 31/143 (22%)
RRM_SF 6..70 CDD:302621 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.