DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and Elavl4

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_006238653.1 Gene:Elavl4 / 432358 RGDID:1560027 Length:393 Species:Rattus norvegicus


Alignment Length:387 Identity:215/387 - (55%)
Similarity:265/387 - (68%) Gaps:64/387 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKNGSANGSVDG----------------SNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCK 56
            |.||..:.:.:|                :.|:|:||||||||||.|||||.||||.||||:||||
  Rat    25 VSNGPTSNTSNGPSSNNRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCK 89

  Fly    57 LVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYAR 121
            |||||::                  |||||||||||:..:|||||:|||||||||.|.|||||||
  Rat    90 LVRDKIT------------------GQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYAR 136

  Fly   122 PSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAER 186
            |||.||:.||||||||||.::|.:||.:|:.:|:|||||||.|.::|:|:||||||||:|.|||.
  Rat   137 PSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEE 201

  Fly   187 AIQELNGKTPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTP---------------------- 229
            ||:.|||:.|.|..||||||||||||..:...:...|  |.:|                      
  Rat   202 AIKGLNGQKPSGATEPITVKFANNPSQKSSQALLSQL--YQSPNRRYPGPLHHQAQRFRLDNLLN 264

  Fly   230 QAAAATRRLAGAL-PSAGRIRYSPLAGDLLANSI---LPGNAMTGSGWCIFVYNLAPETEENVLW 290
            .|....|.::|.: |||...|:||:..|.:.:.:   :||:  ||:|||||||||:|:::|:|||
  Rat   265 MAYGVKRLMSGPVPPSACPPRFSPITIDGMTSLVGMNIPGH--TGTGWCIFVYNLSPDSDESVLW 327

  Fly   291 QLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNK 352
            |||||||||.:||||||..|:||||||||||||||||.:||.|||||.||:|||||||||||
  Rat   328 QLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 210/356 (59%)
Elavl4XP_006238653.1 ELAV_HUD_SF 56..392 CDD:273741 210/356 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5544
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 416 1.000 Inparanoid score I1763
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8987
orthoMCL 1 0.900 - - OOG6_103306
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.