DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and eIF3g2

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650887.1 Gene:eIF3g2 / 42422 FlyBaseID:FBgn0038796 Length:273 Species:Drosophila melanogaster


Alignment Length:113 Identity:28/113 - (24%)
Similarity:48/113 - (42%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTA 74
            :||.|.......|:|....|.| |.::||:.::..|...||......|.|:|.|           
  Fly   178 SGSKNWGRGRDRDDSSAVRISN-LSESMTETDLEELVKKIGPHTKMYLAREKNS----------- 230

  Fly    75 LNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARP 122
                   |...|:.:|::...:||..|:..|||....:.::.|.:::|
  Fly   231 -------GLCKGFAYVHFKFRQDAAAAIEVLNGHGYDHLILCVEWSKP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 24/100 (24%)
eIF3g2NP_650887.1 eIF3g 28..137 CDD:289149
RRM <171..>256 CDD:223796 24/96 (25%)
RRM_eIF3G_like 194..270 CDD:240854 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.