DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and CG5213

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:213 Identity:67/213 - (31%)
Similarity:107/213 - (50%) Gaps:29/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSL 85
            |...:||||:|||||.||:.|:..|||..||:...|::|.:                  :.|.|.
  Fly    36 NLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHR------------------RTGISC 82

  Fly    86 GYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMF 150
            .||||:||....|..|||.::|...:.|.:||::||||......::|||..||..:.:..:..:|
  Fly    83 CYGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELF 147

  Fly   151 ASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSA 215
            |::|.|:...:|....:..|:||.|::|:...:||.|...::....:|.:.|:||||.......:
  Fly   148 ATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGS 212

  Fly   216 -----------KAQIAPP 222
                       |.:.:||
  Fly   213 SSTSSGSQYKDKRKSSPP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 66/211 (31%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 35/93 (38%)
RRM 128..202 CDD:214636 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.