DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and lark

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_523957.1 Gene:lark / 38811 FlyBaseID:FBgn0011640 Length:352 Species:Drosophila melanogaster


Alignment Length:234 Identity:54/234 - (23%)
Similarity:96/234 - (41%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNY 92
            |.:..|.:.....|:|:||...|.:..|.:|::                          ||||:.
  Fly     9 LFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------------------------YGFVHM 47

  Fly    93 VRAEDAEKAVNTLNGLRLQNKVIKVSYAR----PSSESIKGANLYVSGLPKNLSQPDLEGMFASF 153
            ...:....|:..|||..|....|||..|:    |::.:.|   ::|..|......|::..:|..:
  Fly    48 ETEQQGRDAIQNLNGYTLNEFAIKVEAAKSRRAPNTPTTK---IFVGNLTDKTRAPEVRELFQKY 109

  Fly   154 GKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ 218
            |.::.    ||    :.:..||:..|...:.:.||:||||:...|  :|:.|:.:.:... .|..
  Fly   110 GTVVE----CD----IVRNYGFVHLDCVGDVQDAIKELNGRVVDG--QPLKVQVSTSRVR-PKPG 163

  Fly   219 IAPPLTAYLTPQAAAATR---RLAGALPSAGRIRYSPLA 254
            :..|...|...::...::   ||.|: ...||...|||:
  Fly   164 MGDPEQCYRCGRSGHWSKECPRLYGS-AGGGREPPSPLS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 54/234 (23%)
larkNP_523957.1 RRM1_2_CoAA_like 8..73 CDD:409779 20/89 (22%)
RRM1_2_CoAA_like 87..152 CDD:409779 19/77 (25%)
hnRNP-R-Q <88..>258 CDD:273732 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.