DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and hfp

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:256 Identity:64/256 - (25%)
Similarity:101/256 - (39%) Gaps:77/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKA 101
            :.::.:|..|:..|.::|..:..|                |..|:.:  |:.||.|...|.|:.|
  Fly   141 LKEDTIRVAFTPFGPIKSINMSWD----------------PITQKHK--GFAFVEYEIPEGAQLA 187

  Fly   102 VNTLNGLRLQNKVIKVSYARPSS------------ESIKGAN-LYVSGLPKNLSQPDLEGMFASF 153
            :..:||..:..:.|||  .|||:            |..|..| :||:.:..:||:.|::.:|.:|
  Fly   188 LEQMNGALMGGRNIKV--GRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVFEAF 250

  Fly   154 GKIITSRILCDNISGLS----KGVGFIRFDQRNEAERAIQELN-----------GKT---PKGYA 200
            |.|    :.|....|.|    ||.|||.:..:...:.||..:|           |::   |...|
  Fly   251 GPI----LYCKLAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLLRVGRSITPPNALA 311

  Fly   201 EPITVKFANNPSNSAKAQIAPPLTAYL-----------------TP-QAAAATRRLAGALP 243
            .|.|    |:...:|.|..|...||.:                 || .||.|.....||:|
  Fly   312 CPTT----NSTMPTAAAVAAAAATAKIQALDAVASNAVLGLSQNTPVMAAGAVVTKVGAMP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 64/256 (25%)
hfpNP_525123.2 half-pint 10..637 CDD:130706 64/256 (25%)
RRM1_PUF60 130..205 CDD:240816 19/83 (23%)
RRM2_PUF60 227..303 CDD:240817 22/79 (28%)
RRM3_UHM_PUF60 536..636 CDD:241092
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.