DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and rbm14a

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001108616.1 Gene:rbm14a / 323721 ZFINID:ZDB-GENE-050522-496 Length:471 Species:Danio rerio


Alignment Length:335 Identity:71/335 - (21%)
Similarity:130/335 - (38%) Gaps:76/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSL 85
            :|.|...|.|..|....||:::.:||:..||:....::|.                         
Zfish     2 DDSSAVKLFVGNLDLETTQDDLIALFAPFGEVVHITVLRQ------------------------- 41

  Fly    86 GYGFVNYVRAEDAEKAVNTLNG--LRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEG 148
             :.||:......|:.|:..|||  .|.::.|::.|..||    :....::|..|..:.|..||..
Zfish    42 -FAFVHLQGEGAADSAIRDLNGREYRGRSLVVEESKGRP----LNSTKVFVGNLCASCSVEDLYD 101

  Fly   149 MFASFGKIITSRILCDNI----SGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFAN 209
            :|:.:||::.    ||.:    |.|: |..|:..:.:.:||:||:.|:|.|..|  .|:.|:.:.
Zfish   102 LFSPYGKVLD----CDKVKTKPSSLT-GYAFVYMEHKEDAEQAIEGLHGTTFMG--RPLAVELSK 159

  Fly   210 NPSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLLANSILPGNAMTGSGWC 274
            ...::.|...|          :..|....||..|    |...|:.......::|...|...:|  
Zfish   160 VQQSTNKVPCA----------SCGAHGHFAGECP----INRPPMEHHQSQAAVLAAAAAAAAG-- 208

  Fly   275 IFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKG-------FGFVTMTNYDEAVVAI- 331
                 |..:.:::|....:....:..:...::||.||:..|       :|.:....|......: 
Zfish   209 -----LPLQVQQSVHNSFYNTASSDPTFAALKDLTTSRVDGKPVSSMVYGALASQVYSSVADQVI 268

  Fly   332 ----QSLNGY 337
                |:..||
Zfish   269 GSTSQTAEGY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 70/333 (21%)
rbm14aNP_001108616.1 RRM_SF 7..75 CDD:302621 19/93 (20%)
RRM_SF 84..156 CDD:302621 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.