DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and Spx

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:234 Identity:58/234 - (24%)
Similarity:100/234 - (42%) Gaps:57/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEA 184
            |.|.:|..:.|.:|..||...:|:..|..:|...|.::...:..|.::.:.:|.||:.|....:|
  Fly     3 AGPIAERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDA 67

  Fly   185 ERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIR 249
            :..|:.:|  ..|.|.:||.|.                       :|:|..:.|           
  Fly    68 DYGIKIMN--MIKLYGKPIRVN-----------------------KASAHQKNL----------- 96

  Fly   250 YSPLAGDLLANSILPGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAV-QSVKVIRDLQTSKC 313
                  |:.||              ||:.||..|.:|.:|:..|..||.: |:.|::||.:|.|.
  Fly    97 ------DVGAN--------------IFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKS 141

  Fly   314 KGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNK 352
            |.|.|:...:::.:..|:.::||..|.||.:.||:...|
  Fly   142 KSFAFINFASFEASDAAMDAMNGQYLCNRPISVSYAFKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 58/234 (25%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 20/97 (21%)
RRM2_SF3B4 99..181 CDD:240781 30/96 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.