DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and eIF3g1

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_570011.1 Gene:eIF3g1 / 31243 FlyBaseID:FBgn0029629 Length:269 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:104/277 - (37%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 KVIKVSYA----------RPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNI- 166
            :.||.|:|          .|::|:::....||:....|......        |::.:..:...: 
  Fly     5 ETIKSSWADEVELDYGGLPPTTETVENGQKYVTEYKYNKDDKKT--------KVVRTYKISKQVV 61

  Fly   167 -SGLSKGVGFIRF-DQRNE------------AERAIQELNGKTPKGYAEPITVKFANNPS-NSAK 216
             ..::|...:.:| |.:|:            .|..:|.||.|..:...:|:.     :|: |.||
  Fly    62 PKTVAKRRTWTKFGDSKNDKPGPNSQTTMVSEEIIMQFLNSKEDEKANDPLL-----DPTKNIAK 121

  Fly   217 AQI-------------APPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLLANSILPGNAM 268
            .:|             ...:...:..:.|:|....|...|.:|  :|.|   ..|.:|......|
  Fly   122 CRICNGEHWSVNCPYKGTAMDTNMMEKKASAAAAAAVDAPKSG--KYVP---PFLKDSQKGALGM 181

  Fly   269 TG--SGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAI 331
            .|  ....|.:.||:....|..|.:|....|....:.:.||..|..||||.:|......:|..||
  Fly   182 RGRDDTAAIRISNLSESMTEADLEELVKKIGPQSKMYLARDKNTGLCKGFAYVHFKQRKDAAAAI 246

  Fly   332 QSLNGYTLGNRVLQVSF 348
            :.|||:...:.:|.|.:
  Fly   247 EILNGHGYDHLILSVEW 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 59/277 (21%)
eIF3g1NP_570011.1 eIF3g 30..140 CDD:289149 19/122 (16%)
RRM <161..>269 CDD:223796 31/108 (29%)
RRM_eIF3G_like 189..265 CDD:240854 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.