DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and ssx

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:240 Identity:87/240 - (36%)
Similarity:125/240 - (52%) Gaps:48/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KNGSANGSVDG---SNDE---------------------------SRTNLIVNYLPQTMTQEEMR 43
            :||......||   |.||                           |.||||:|||||.||..|:.
  Fly    46 ENGDGGNGGDGQEHSGDEEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELY 110

  Fly    44 SLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGL 108
            :|||..|.:.:||::||                  .:.|.|.|||||:|....|:|.|:..|||.
  Fly   111 NLFSGCGPINTCKIMRD------------------FKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157

  Fly   109 RLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGV 173
            .::||.:|||||||..:|||..||||..|.:|::...|:.:|:.:|.|:...||.|.::|..:||
  Fly   158 YVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGV 222

  Fly   174 GFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ 218
            .|:|:::|.||:.||:.||...|:|.::||.|:.|.....:..||
  Fly   223 AFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 81/223 (36%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 43/97 (44%)
RRM_SF 179..257 CDD:302621 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439626
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.