DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and elav

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster


Alignment Length:366 Identity:222/366 - (60%)
Similarity:272/366 - (74%) Gaps:33/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NGSA-NGSVDGSN--DESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPAS 71
            ||:| :||.:|||  .|:||||||||||||||::|:||||||:||:||.||:|||..      ..
  Fly   130 NGNAGSGSQNGSNGSTETRTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQ------VY 188

  Fly    72 LTALNP-ALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVS 135
            :..||| |..:|||||||||||||.:|||:|||.|||||||||.||||:|||||::|||||||||
  Fly   189 IDPLNPQAPSKGQSLGYGFVNYVRPQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIKGANLYVS 253

  Fly   136 GLPKNLSQPDLEGMFASFGKIITSRILCDNISG--LSKGVGFIRFDQRNEAERAIQELNGKTPKG 198
            ||||.::|.:||.:||.||.||||||| .|...  .:|||||||||:|.||.|||..|||.||..
  Fly   254 GLPKTMTQQELEAIFAPFGAIITSRIL-QNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSS 317

  Fly   199 YAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGAL---PSAGRIRYSPLAGDLLAN 260
            ..:||.|||:|.|.:::|. |.|.|.|:|.||   ..||:.||:   .:.|..|:||:|||:| :
  Fly   318 CTDPIVVKFSNTPGSTSKI-IQPQLPAFLNPQ---LVRRIGGAMHTPVNKGLARFSPMAGDML-D 377

  Fly   261 SILPGN-------AMT-----GSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKC 313
            .:||..       |.|     |..:.||:|||||||||..|||||||||||||||:::|..|::|
  Fly   378 VMLPNGLGAAAAAATTLASGPGGAYPIFIYNLAPETEEAALWQLFGPFGAVQSVKIVKDPTTNQC 442

  Fly   314 KGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNKTK 354
            ||:|||:|||||||.:||::|||||:|||||||||||||.|
  Fly   443 KGYGFVSMTNYDEAAMAIRALNGYTMGNRVLQVSFKTNKAK 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 213/348 (61%)
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 213/348 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5464
eggNOG 1 0.900 - - E1_KOG0145
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I1971
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
98.970

Return to query results.
Submit another query.