DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and SPAC644.16

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_593884.1 Gene:SPAC644.16 / 2543462 PomBaseID:SPAC644.16 Length:422 Species:Schizosaccharomyces pombe


Alignment Length:76 Identity:24/76 - (31%)
Similarity:42/76 - (55%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 IFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTL 339
            ::|.|:..|..|..:..:|...|.|:|.:::.|.::.:.||:||....:...|..|:::||.|..
pombe     7 VYVGNIPYEMAEEQVIDIFKQSGPVKSFQLVIDPESGQPKGYGFCEYHDPATAASAVRNLNNYDA 71

  Fly   340 GNRVLQVSFKT 350
            |.|.|:|.|.|
pombe    72 GTRRLRVDFPT 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 24/76 (32%)
SPAC644.16NP_593884.1 RRM <3..>116 CDD:223796 24/76 (32%)
RRM_CSTF2_RNA15_like 7..81 CDD:240844 22/73 (30%)
CSTF2_hinge 150..222 CDD:291025
CSTF_C 380..413 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.