DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and SPAC328.05

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_594207.3 Gene:SPAC328.05 / 2542567 PomBaseID:SPAC328.05 Length:464 Species:Schizosaccharomyces pombe


Alignment Length:396 Identity:93/396 - (23%)
Similarity:150/396 - (37%) Gaps:94/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MDIVKNGSANGSVDGSND-------------------------ESRTNLIVNYLPQTMTQEEMRS 44
            ||..::.|....|:|||.                         :....:.|..|...:...|::.
pombe    31 MDRDRSESPKRHVNGSNSLKRGLHFDGEHTERDPHLGNGQKYTQQERRVYVGNLSYQVRWFELKE 95

  Fly    45 LFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLR 109
            ....:|.:.:|:::.                   |..|.|.|...:.|..||:|..|:.||:..:
pombe    96 FMGQVGNVLNCEILN-------------------LPNGLSKGCAIIEYSTAEEARTAIKTLSNQK 141

  Fly   110 LQNKVIKV------------SYARPSS-----ESIKGANLYVSGLPKNLSQPDLEGMFASFGKII 157
            ...:::.:            |...||:     :|.....|:|..||.|:...||:.:|...|.:|
pombe   142 FMGRLVYIREDREQNARFGSSSVSPSASSNGKDSEPDRQLFVGNLPYNVRWQDLKDLFRQAGSVI 206

  Fly   158 TSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITV-KFANNPSNSAKAQIAP 221
            .:.|.. |..|.|:|:|.:......||..|||.|:.....|....:.: :||::.|.       |
pombe   207 RADIQM-NQEGRSRGIGIVVMSSMKEAMHAIQMLHNTDFMGRTLEVRLDRFAHHKSK-------P 263

  Fly   222 PLT---AYLTPQAAAATRRLAGALPSAGRIRYSPLAG------DLLANSILPGNAMTGSGWCIFV 277
            ..|   .|..|.....|....          |.|:.|      ||:.::...|....    ||:|
pombe   264 YSTHGNGYTFPAEMQMTTSST----------YLPMLGANTQVEDLVYHAYPHGPCSD----CIYV 314

  Fly   278 YNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNR 342
            .||...|.:..|..||...|:|...::..: .|.:.||||.|...|.::|..:|:.||||..|.|
pombe   315 GNLPWATSDRNLLDLFTDIGSVIRARIAYE-PTGRSKGFGVVQFENENDAASSIEKLNGYRYGGR 378

  Fly   343 VLQVSF 348
            .||:|:
pombe   379 PLQLSY 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 86/353 (24%)
SPAC328.05NP_594207.3 RRM 71..387 CDD:223796 86/356 (24%)
RRM_SF 79..150 CDD:240668 16/89 (18%)
RRM3_hnRNPM_like 181..252 CDD:240833 23/71 (32%)
RRM_SF 312..385 CDD:302621 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.