DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and bru2

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:641 Identity:126/641 - (19%)
Similarity:193/641 - (30%) Gaps:321/641 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MDIVKNGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLP 69
            |:::::.|.: |:....|.....:.|..:|:|..:..:|.:|...|.:.:..::||||       
  Fly   275 MELMESTSPD-SIKDQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKV------- 331

  Fly    70 ASLTALNPALQQGQSLGYGFVNY------VRAEDAEKAVNTLNGLR--LQNKVIKVSYARPS-SE 125
               |::        |.|..||.|      :||:||...:.||:|:.  :|.|        |: ||
  Fly   332 ---TSI--------SRGCCFVTYYTRKAALRAQDALHNIKTLDGMHHPIQMK--------PADSE 377

  Fly   126 SIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQE 190
            :.....|:|..|.|..::.|:..:|...|.|....:|.|. :|.|||..|:.|..:..|..||:.
  Fly   378 NRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRDQ-AGQSKGCAFVTFATKQNAIGAIKA 441

  Fly   191 LN-GKTPKGYAEPITVKFA--------------------NNPS-----------NSAKAQIAPP- 222
            |: .:|.:|.:.|:.||||                    |.||           |:|.|.||.| 
  Fly   442 LHQSQTMEGCSAPLVVKFADTQKEKDQKKMQQIHAFCGINTPSGATAGAATPTINAATALIAAPP 506

  Fly   223 ----------------------------------------LTAYLTPQ----------------- 230
                                                    |:|.|||.                 
  Fly   507 SAGRTNPSMAAALAAVPQVQQAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAY 571

  Fly   231 --------------------------------------------------------------AAA 233
                                                                          |.|
  Fly   572 LGADPAAAAHLQLYQQLHGYGLSPAHYLPGLNFHHPPENSAHHSQHSPGIGGASAASLSAAAATA 636

  Fly   234 ATRRLAGALP-------SAG--------------------------------------------- 246
            |:..|.||.|       |||                                             
  Fly   637 ASNPLGGAPPPTPTPTSSAGHAAGAGLLAAPSMSMQNLVALLATPTAHHQLSLHHSSSSSGHNNG 701

  Fly   247 -----------RIRYS------PL----------------------AGDLLANSILPGNA----- 267
                       |:.|:      |:                      :..|..|::.|.||     
  Fly   702 NSSATSGLHNQRLTYAAAPPPPPISTTYNMPQLIGHTATPTQPGGSSQSLTFNALWPPNAADPYS 766

  Fly   268 ------------------------------MTG------SGWCIFVYNLAPETEENVLWQLFGPF 296
                                          :||      .|..:|:|:|..|..:..|...|.||
  Fly   767 SSLSGLTNGAAYGAASQPVTTSALQAAAAGVTGKQIEGPDGSNLFIYHLPQEFIDTDLASTFLPF 831

  Fly   297 GAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNK 352
            |.|.|.||..|.||:..|.||||:..|...|..|||:::|:.:|::.|:|..|.:|
  Fly   832 GNVLSAKVFIDKQTNLSKCFGFVSYDNPHSANAAIQAMHGFQIGSKRLKVQLKRSK 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 122/623 (20%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 26/106 (25%)
RRM2_Bruno_like 381..461 CDD:241080 26/80 (33%)
RRM_SF 801..892 CDD:302621 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.