DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and ELAVL3

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_024307178.1 Gene:ELAVL3 / 1995 HGNCID:3314 Length:424 Species:Homo sapiens


Alignment Length:424 Identity:214/424 - (50%)
Similarity:256/424 - (60%) Gaps:108/424 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTA 74
            ||...|: :|:.|:|:||||||||||.|||:|.:|||.|||::|||||||||::           
Human    24 NGPLLGT-NGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKIT----------- 76

  Fly    75 LNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPK 139
                   |||||||||||....||:||:||||||:||.|.||||||||||.||:.||||||||||
Human    77 -------GQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPK 134

  Fly   140 NLSQPDLEGMFASFGKIITSRILCDNI-------------------------------------- 166
            .:||.::|.:|:.:|:|||||||.|.:                                      
Human   135 TMSQKEMEQLFSQYGRIITSRILVDQVTGQAVREGAPGGGAGQRQSGGTNVGKPTKMPGHEAGKG 199

  Fly   167 -------------------SGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPS 212
                               :|:|:||||||||:|.|||.||:.|||:.|.|.|||||||||||||
Human   200 EVGLHRRGQGRRDGHPCPLAGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPS 264

  Fly   213 NSAKAQIAPPLTAYLTPQAAAATRRLAGAL---------------------PSAGRIRYSPLAGD 256
            ....       .|.||....::.||.||.|                     |.:...|:||:|.|
Human   265 QKTG-------QALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAID 322

  Fly   257 ---LLANSILPGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGF 318
               .||...|.|.| .|:|||||||||:||.:|:||||||||||||.:||||||..|:|||||||
Human   323 GMSGLAGVGLSGGA-AGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGF 386

  Fly   319 VTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNK 352
            |||||||||.:||.|||||.||.|||||||||:|
Human   387 VTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 209/411 (51%)
ELAVL3XP_024307178.1 RRM 36..423 CDD:330708 209/411 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5685
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 419 1.000 Inparanoid score I1806
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8515
orthoMCL 1 0.900 - - OOG6_103306
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3804
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.