DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and ELAVL1

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens


Alignment Length:340 Identity:201/340 - (59%)
Similarity:246/340 - (72%) Gaps:31/340 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQG 82
            |...|..|||||||||||.|||:|:|||||||||:||.||:||||:|:                 
Human    12 DCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGH----------------- 59

  Fly    83 QSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLE 147
             ||||||||||.|:|||:|:|||||||||:|.|||||||||||.||.||||:||||:.::|.|:|
Human    60 -SLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVE 123

  Fly   148 GMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPS 212
            .||:.||:||.||:|.|..:|||:||.|||||:|:|||.||...||..|.|.:||||||||.||:
Human   124 DMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPN 188

  Fly   213 NSAKAQIAPPLTAYLTPQAAAATRRLAGAL-PSAGRIRYSPLAGDL---LANSILPGNAMTGSGW 273
            .:....:...|  |.:|     .||..|.: ..|.|.|:||:..|.   |:...:||||  .|||
Human   189 QNKNVALLSQL--YHSP-----ARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA--SSGW 244

  Fly   274 CIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYT 338
            |||:|||..:.:|.:|||:|||||||.:||||||..|:|||||||||||||:||.:||.|||||.
Human   245 CIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYR 309

  Fly   339 LGNRVLQVSFKTNKT 353
            ||:::|||||||||:
Human   310 LGDKILQVSFKTNKS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 199/335 (59%)
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 199/333 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5685
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 419 1.000 Inparanoid score I1806
Isobase 1 0.950 - 0.861654 Normalized mean entropy S149
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8515
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.