DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and Elavl3

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_034617.1 Gene:Elavl3 / 15571 MGIID:109157 Length:367 Species:Mus musculus


Alignment Length:367 Identity:214/367 - (58%)
Similarity:255/367 - (69%) Gaps:51/367 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTA 74
            ||...|: :|:.|:|:||||||||||.|||:|.:|||.|||::|||||||||::           
Mouse    24 NGPLLGT-NGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKIT----------- 76

  Fly    75 LNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPK 139
                   |||||||||||....||:||:||||||:||.|.||||||||||.||:.||||||||||
Mouse    77 -------GQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPK 134

  Fly   140 NLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPIT 204
            .:||.::|.:|:.:|:|||||||.|..:|:|:||||||||:|.|||.||:.|||:.|.|.|||||
Mouse   135 TMSQKEMEQLFSQYGRIITSRILLDQATGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPIT 199

  Fly   205 VKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAGAL---------------------PSAGRI 248
            ||||||||....       .|.||....::.||.||.|                     |.:...
Mouse   200 VKFANNPSQKTG-------QALLTHLYQSSARRYAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIA 257

  Fly   249 RYSPLAGD---LLANSILPGNAMTGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQT 310
            |:||:|.|   .||...|.|.| .|:|||||||||:||.:|:||||||||||||.:||||||..|
Mouse   258 RFSPIAIDGMSGLAGVGLSGGA-AGAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTT 321

  Fly   311 SKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNK 352
            :||||||||||||||||.:||.|||||.||.|||||||||:|
Mouse   322 NKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 209/354 (59%)
Elavl3NP_034617.1 ELAV_HUD_SF 36..366 CDD:273741 209/354 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5668
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 420 1.000 Inparanoid score I1774
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8744
orthoMCL 1 0.900 - - OOG6_103306
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3804
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.