DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and Elavl1

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_034615.2 Gene:Elavl1 / 15568 MGIID:1100851 Length:326 Species:Mus musculus


Alignment Length:340 Identity:200/340 - (58%)
Similarity:247/340 - (72%) Gaps:31/340 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DGSNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQG 82
            |..:|..|||||||||||.|||||:|||||||||:||.||:||||:|:                 
Mouse    12 DCRDDIGRTNLIVNYLPQNMTQEELRSLFSSIGEVESAKLIRDKVAGH----------------- 59

  Fly    83 QSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLE 147
             ||||||||||.|:|||:|::||||||||:|.|||||||||||.||.||||:||||:.::|.|:|
Mouse    60 -SLGYGFVNYVTAKDAERAISTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVE 123

  Fly   148 GMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPS 212
            .||:.||:||.||:|.|..:|||:||.|||||:|:|||.||...||..|.|.:||||||||.||:
Mouse   124 DMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPN 188

  Fly   213 NSAKAQIAPPLTAYLTPQAAAATRRLAGAL-PSAGRIRYSPLAGDLLANSI---LPGNAMTGSGW 273
            .:....:...|  |.:|     .||..|.: ..|.|.|:||:..|.::...   :||||  .|||
Mouse   189 QNKNMALLSQL--YHSP-----ARRFGGPVHHQAQRFRFSPMGVDHMSGISGVNVPGNA--SSGW 244

  Fly   274 CIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYT 338
            |||:|||..:.:|.:|||:|||||||.:||||||..|:|||||||||||||:||.:||.|||||.
Mouse   245 CIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYR 309

  Fly   339 LGNRVLQVSFKTNKT 353
            ||:::|||||||||:
Mouse   310 LGDKILQVSFKTNKS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 198/335 (59%)
Elavl1NP_034615.2 ELAV_HUD_SF 19..326 CDD:273741 198/333 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5668
eggNOG 1 0.900 - - E1_KOG0145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 420 1.000 Inparanoid score I1774
Isobase 1 0.950 - 0.861654 Normalized mean entropy S149
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm8744
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X326
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.890

Return to query results.
Submit another query.