DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fne and elavl4

DIOPT Version :9

Sequence 1:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_012815941.1 Gene:elavl4 / 100125165 XenbaseID:XB-GENE-948210 Length:430 Species:Xenopus tropicalis


Alignment Length:390 Identity:221/390 - (56%)
Similarity:270/390 - (69%) Gaps:53/390 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKNGSANGSVDG----------------SNDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCK 56
            |.||..:.:.:|                :.|:|:||||||||||.|||||.||||.||||:||||
 Frog    47 VSNGPTSNTSNGPSSNSRNCPSPMQTGAATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCK 111

  Fly    57 LVRDKVSG--------NLVLPAS---LTALNPALQQGQSLGYGFVNYVRAEDAEKAVNTLNGLRL 110
            |||||::|        :|.....   ||...|...:|||||||||||:..:|||||:||||||||
 Frog   112 LVRDKITGTQFEEHFKDLATGTKWKPLTEEGPIFGKGQSLGYGFVNYIDPKDAEKAINTLNGLRL 176

  Fly   111 QNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGF 175
            |.|.||||||||||.||:.||||||||||.::|.:||.:|:.:|:|||||||.|.::|:|:||||
 Frog   177 QTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGF 241

  Fly   176 IRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRRLAG 240
            ||||:|.|||.||:.|||:.|.|.|||||||||||||......:...|  |.:|     .||..|
 Frog   242 IRFDKRIEAEEAIKGLNGQKPSGAAEPITVKFANNPSQKTSQALLSQL--YQSP-----NRRYPG 299

  Fly   241 AL--------------PSAGRIRYSPLAGDLLANSI---LPGNAMTGSGWCIFVYNLAPETEENV 288
            .|              .:.|..|:||:..|.:.:.:   :||:  ||:|||||||||:|:::|:|
 Frog   300 PLHHQAQRFRLDNLLNMAYGVKRFSPITIDGMTSLVGMNIPGH--TGTGWCIFVYNLSPDSDESV 362

  Fly   289 LWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRVLQVSFKTNKT 353
            |||||||||||.:||||||..|:||||||||||||||||.:||.|||||.||:||||||||||||
 Frog   363 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKT 427

  Fly   354  353
             Frog   428  427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 216/359 (60%)
elavl4XP_012815941.1 ELAV_HUD_SF 78..429 CDD:273741 216/359 (60%)
RRM1_Hu 80..186 CDD:241094 67/105 (64%)
RRM_SF 191..280 CDD:302621 59/88 (67%)
RRM3_HuD 344..429 CDD:241100 68/84 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5618
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 414 1.000 Inparanoid score I1795
OMA 1 1.010 - - QHG55893
OrthoDB 1 1.010 - - D425303at33208
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm9409
Panther 1 1.100 - - O PTHR10352
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3804
SonicParanoid 1 1.000 - - X326
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.