DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and yipf2

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001003500.1 Gene:yipf2 / 445106 ZFINID:ZDB-GENE-040724-124 Length:304 Species:Danio rerio


Alignment Length:286 Identity:114/286 - (39%)
Similarity:166/286 - (58%) Gaps:34/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SSAQGFSGAASSG----------GSQPQNSSLDGSAGGGGGGAKLSLFTIEYYQQFFNVDTYMVL 125
            ||:...:.||.||          .:|.::|.|.|.....||     .:|.||||.||||||..||
Zfish    31 SSSNPAAAAAPSGEVRLDLSDDEENQQESSELLGGEKKTGG-----FWTFEYYQSFFNVDTVQVL 90

  Fly   126 ERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHY--N 188
            :||..|::| ....|:::.:|..||||||||||.|||:||:|||||::::|.:..:. ::||  .
Zfish    91 DRIKGSVMP-LPGRNFIKHHIRSNPDLYGPFWICVTLVFSLAISGNLSTFLSEMGNP-EYHYRPQ 153

  Fly   189 FHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLAIYI 253
            ||.||.||.::||||.::|..:|....:       ..:||.....|  :.|..:|:|||||.|||
Zfish   154 FHRVSIAAVTVFLYAWLVPLGVWGFLTW-------RQSVERQINGY--TFLETVCVYGYSLFIYI 209

  Fly   254 PVSILWVINISLLQWLLVITAALLSGTVLIAVLTPALR-NSQFSLFLIVGILSA-HVVLAAGFLL 316
            |.|:||.|..:.|||||::.|.::||:||:....||:| :::.:.|..|.::.| |.:||.|..|
Zfish   210 PTSVLWTIPFNWLQWLLIVVAMVISGSVLVITFWPAVRDDTKLTAFATVAVIVALHALLAVGCKL 274

  Fly   317 YFFHNPTVPSLDPVAPTPAAPAAPAA 342
            ||||.    :.|..:|.|.....||:
Zfish   275 YFFHT----AEDTRSPHPGQHITPAS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 70/164 (43%)
yipf2NP_001003500.1 Yip1 103..264 CDD:309843 70/170 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594369
Domainoid 1 1.000 153 1.000 Domainoid score I4259
eggNOG 1 0.900 - - E1_KOG3114
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3882
OMA 1 1.010 - - QHG54497
OrthoDB 1 1.010 - - D1425332at2759
OrthoFinder 1 1.000 - - FOG0001880
OrthoInspector 1 1.000 - - otm26245
orthoMCL 1 0.900 - - OOG6_101326
Panther 1 1.100 - - LDO PTHR12822
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1890
SonicParanoid 1 1.000 - - X1411
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.