DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and Yipf2

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001014230.1 Gene:Yipf2 / 363027 RGDID:1307512 Length:311 Species:Rattus norvegicus


Alignment Length:305 Identity:103/305 - (33%)
Similarity:145/305 - (47%) Gaps:56/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VGGG-GANAQRQRGDPLADLIYDMTSSAQGFSGAASSGGSQPQNSSLDGSAGGGGGGAKLSLFTI 110
            ||.| |..|:.:..|....|:.|                .:||.                ..:|.
  Rat    44 VGSGIGYGAEGEEEDDKTSLLQD----------------EKPQP----------------RFWTF 76

  Fly   111 EYYQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISGNIASY 175
            :|||.||:|||..||:||..|::| ....|::|.::...|||||||||..||.|.:|::||:...
  Rat    77 DYYQSFFDVDTSQVLDRIKGSLLP-HPGHNFVRHHLRNRPDLYGPFWICATLAFVLAVTGNLTLV 140

  Fly   176 LQQATDAYKWHYN--FHLVSYAATSIFLYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSL 238
            |.|..|. ..||:  ||.|:.|..:|:.||.::|..||...::         ...|.....:.:.
  Rat   141 LAQRRDP-SIHYSPQFHKVTIAGITIYCYAWLVPLALWGFLRW---------RQGTRERMGLYTF 195

  Fly   239 LSLMCIYGYSLAIYIPVSILWVINISLLQWLLVITAALLSGTVLIAVLTPALRNS----QFSLFL 299
            |..:|:|||||.::||..:||:|.:..||||....|..||...|:..|.|.:|..    ..:|..
  Rat   196 LETVCVYGYSLFVFIPTVVLWLIPVQWLQWLFGALALALSAAGLVFTLWPVVREDTRLVAAALLS 260

  Fly   300 IVGILSAHVVLAAGFLLYFFHNPTVPSLDPVAPTP-AAPAAPAAL 343
            ||.:|  |.:||.|..||||.  .:| ||.|.|.| |.|.:|..|
  Rat   261 IVVLL--HALLALGCKLYFFQ--PLP-LDHVVPAPQAIPPSPNVL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 59/166 (36%)
Yipf2NP_001014230.1 Yip1 83..>218 CDD:282716 54/145 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352443
Domainoid 1 1.000 139 1.000 Domainoid score I4661
eggNOG 1 0.900 - - E1_KOG3114
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I3931
OMA 1 1.010 - - QHG54497
OrthoDB 1 1.010 - - D1425332at2759
OrthoFinder 1 1.000 - - FOG0001880
OrthoInspector 1 1.000 - - otm46158
orthoMCL 1 0.900 - - OOG6_101326
Panther 1 1.100 - - LDO PTHR12822
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1411
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.