DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4645 and yipf3

DIOPT Version :9

Sequence 1:NP_001285171.1 Gene:CG4645 / 32244 FlyBaseID:FBgn0030435 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_956201.1 Gene:yipf3 / 334511 ZFINID:ZDB-GENE-030131-6443 Length:344 Species:Danio rerio


Alignment Length:388 Identity:90/388 - (23%)
Similarity:149/388 - (38%) Gaps:118/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NVNSPTHGGSGGS---GGGSA---------GSGGSVGGGGANAQRQRGDPLADLIYDMTSSAQ-- 74
            |.|:...||...:   |.|||         .||.|....|...||.|.:.      ::|:.|.  
Zfish     9 NTNAEPWGGFDDNIIQGTGSAVIDMENMDDTSGSSFEDVGEMHQRMREEE------EVTAEAAAT 67

  Fly    75 -----------GFSGAASSGGSQPQNSSLDGSAGGGGGGAKLSLF-TIEYYQQFFNVDTYMVLER 127
                       |..|.....|.|..:..  ..||........:|: .|:..:.:|:|:...|..|
Zfish    68 EEDNGEYGEFLGMKGLKGQLGRQVADEV--WQAGKRQASKAFNLYANIDILRPYFDVEPIQVRNR 130

  Fly   128 IANSMIPKRASGNYLRMNIGENPDLYGPFWITVTLIFSIAISG--NIASYLQQATDAYKWHYNFH 190
            :..|:||.|.. |:.:...||   ||||..:..||: :|.:.|  ...:.:::.|          
Zfish   131 LVESLIPVRMI-NFPQKVAGE---LYGPMMLVFTLV-AILLHGMKTSGTVIREGT---------- 180

  Fly   191 LVSYAATSIFLYANILPAVLW---ALFKYSLKPVDSADAVETDSASYMPSLLSLM--CIYGYSLA 250
            |:..|..:.|.|        |   :.|.|.|..:.:|...       |..:|||:  .::|:.:.
Zfish   181 LMGTAIGTGFGY--------WLGVSSFIYFLAYLCNAQIT-------MLQMLSLLGYGLFGHCVV 230

  Fly   251 IYIPVSI--------LWVI--NISLLQWLLVITAALLSGTVLIAVLTPALRNSQFSLFLIVGILS 305
            ::|..::        ||::  .:|.|:    :.|.|:|.||   ..||.|        ::.|.|:
Zfish   231 LFITYNVHFHSLFYLLWMVIGGLSTLR----MVAVLISRTV---GQTPRL--------ILCGSLA 280

  Fly   306 A-HVVLAAGFLLYF---FH-----------NPTVPSLDPVA---PTPAAPAAPAALKAVTQAV 350
            | |::    ||||.   :|           .|.:|.:..||   |..|:....|.:|::...|
Zfish   281 ALHML----FLLYLHFAYHKMVEGILDTLEGPNIPPIQRVARDVPVVASAVVNATVKSIAAIV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4645NP_001285171.1 Yip1 149..310 CDD:282716 40/178 (22%)
yipf3NP_956201.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.